Protein coding transcript 263478

• Transcript: Ll_transcript_113001
• CDS coordinates: 2-331 (+)
• Peptide sequence: SKEVIKSNILTQITNASQMIRLEKDPHAAFALIIEGKTLTYALEDDVKHHFLGLAVDCASVICCRVSPKQKALVTRLVKQGTGKTTLAIGDGANDVGMIQEADIGVGISG
• ORF Type: internal

Annotations of Ll_transcript_113001

• Blastp: Probable phospholipid-transporting ATPase 5 from Arabidopsis with 85.45% of identity
• Blastx: Probable phospholipid-transporting ATPase 5 from Arabidopsis with 85.45% of identity
• Eggnog: Phospholipid-transporting atpase(ENOG410XPYK)
• Kegg: Link to kegg annotations (AT1G72700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458066.1)
• Pfam: haloacid dehalogenase-like hydrolase (PF08282.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;