Protein coding transcript 263480

• Transcript: Ll_transcript_115154
• CDS coordinates: 3-344 (+)
• Peptide sequence: AHLRRQFAYSYYKRLQKAAIVTQCCWRRRVAKRELRNLKMAARETGALKEAKDKLEKRVEELTWRLQIEKRLRTDLEEDKAQEIAKLQDTLHTMQKQVEEANARVIKEREVAQK
• ORF Type: internal

Annotations of Ll_transcript_115154

• Blastp: Myosin-17 from Arabidopsis with 71.93% of identity
• Blastx: Myosin-17 from Arabidopsis with 71.93% of identity
• Eggnog: myosin heavy chain(COG5022)
• Kegg: Link to kegg annotations (AT5G20490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455089.1)
• Pfam: IQ calmodulin-binding motif (PF00612.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;