Protein coding transcript 263486

• Transcript: Ll_transcript_115162
• CDS coordinates: 1-309 (+)
• Peptide sequence: SNTSTLLLLLQRTLKATGAASLTPQRRRTASSSLFGRMSQGLRASPQNAGLPYLHGRGQSRLDDLRQVEAKYPALLFKQQLTAFLEKIYGATTYTNTNFCFVT
• ORF Type: internal

Annotations of Ll_transcript_115162

• Blastp: Myosin-17 from Arabidopsis with 84.44% of identity
• Blastx: Myosin-17 from Arabidopsis with 84.44% of identity
• Eggnog: myosin heavy chain(COG5022)
• Kegg: Link to kegg annotations (AT5G20490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004507972.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;