Protein coding transcript 263505

• Transcript: Ll_transcript_115187
• CDS coordinates: 597-947 (+)
• Peptide sequence: METLNSTEPHYIRCVKPNNVLKPAIFENVNIMQQLRCGGVLEAIRISCAGYPTRRTFYEFLNRFGVLAPQVLDGNSDDKVACQMILEKMGMKGYQIGTTKVFLRAGQMAELDARRAE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_115187

• Blastp: Myosin-17 from Arabidopsis with 87.18% of identity
• Blastx: Myosin-17 from Arabidopsis with 75.24% of identity
• Eggnog: myosin heavy chain(COG5022)
• Kegg: Link to kegg annotations (AT5G20490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443084.1)
• Pfam: Myosin head (motor domain) (PF00063.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;