Protein coding transcript 263516

• Transcript: Ll_transcript_115182
• CDS coordinates: 3-497 (+)
• Peptide sequence: EKLQQHFNQHVFKMEQEEYTKEKINWSYIEFIDNQDVLDLIEKKPGGIISLLDEACMFPKSTHETFAQKLYQTLKNNKRFIKPKLSRTSFTISHYAGEVTYLADLFLDKNKDYVVAEHRDVLTASKCSFVASLFPPSPDDSSKSSKFSSIGSRFKVSLVFITLF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_115182

• Blastp: Myosin-11 from Arabidopsis with 81.01% of identity
• Blastx: Myosin-17 from Arabidopsis with 75.1% of identity
• Eggnog: myosin heavy chain(COG5022)
• Kegg: Link to kegg annotations (AT1G54560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463680.1)
• Pfam: Myosin head (motor domain) (PF00063.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;