Protein coding transcript 263524

• Transcript: Ll_transcript_115598
• CDS coordinates: 3-317 (+)
• Peptide sequence: ESKKTLSSTSFQDDSGIDICTFLQLLVAHKRIIFCPSNTDTDLNCCLCMNLIYLLYDTRQNVQHIAIDVFKYLLVHRRAALEDLLVSKPNQGQLLDVLHGGFDKL
• ORF Type: internal

Annotations of Ll_transcript_115598

• Blastp: Protein SPIRRIG from Arabidopsis with 72.38% of identity
• Blastx: Protein SPIRRIG from Arabidopsis with 72.38% of identity
• Eggnog: beige BEACH domain containing protein(ENOG410XNQC)
• Kegg: Link to kegg annotations (AT1G03060)
• CantataDB: Link to cantataDB annotations (CNT0002534)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428216.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;