Protein coding transcript 263526

• Transcript: Ll_transcript_115603
• CDS coordinates: 3-563 (+)
• Peptide sequence: KVDDLKIADDKYDKEMHDNGEYLIRPFLEPFEKIRFKYNCERVVGLDKHDGIFLIGELCLYVIENFYIDDSGCFCEKECEDELSVIDQALGVKKDLFGSVDFQSKSTLSRSSTIKSGIGGRAWAFGGAWGKEKIQRNGKLPHPWQMWKLDSVHEILKRDYQLRPVAIEIFSMDGCNDLLVFHKKERE
• ORF Type: internal

Annotations of Ll_transcript_115603

• Blastp: Protein SPIRRIG from Arabidopsis with 76.19% of identity
• Blastx: BEACH domain-containing protein A2 from Arabidopsis with 71.43% of identity
• Eggnog: beige BEACH domain containing protein(ENOG410XNQC)
• Kegg: Link to kegg annotations (AT1G03060)
• CantataDB: Link to cantataDB annotations (CNT0002534)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455527.1)
• Pfam: PH domain associated with Beige/BEACH (PF14844.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;