Transcript | Ll_transcript_114452 |
---|---|
CDS coordinates | 1-582 (+) |
Peptide sequence | TYNNSFHSSIGMAPYEALYGRKCRTPLCWFETGENLILGPDVVQQTTEKIRMIRENMKTAQSRQKSYYDKRRNLLSFEEGDHVFMRVVPTTGIGRLLKARKLTPKFIGPYQILRKVGPVAYQIALPPLLSNLHNVFHVSQLRKYISDPSHIIEPDSIQLKDNLTFETLPIRISDRSVKILRGKEIALVKVIWSQ |
ORF Type | internal |
Blastp | Transposon Tf2-8 polyprotein from Schizosaccharomyces with 32.45% of identity |
---|---|
Blastx | Transposon Tf2-8 polyprotein from Schizosaccharomyces with 32.45% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPAC13D1.01c) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431322.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer