| Transcript | Ll_transcript_114454 |
|---|---|
| CDS coordinates | 94-474 (+) |
| Peptide sequence | MGENLILGPDVVQQTTEKIRMIRENMKTAQSRQKSYYDKRRNLLSFEEGDHVFMRVVPTTGIGRLLKARKLTPKFIGPYQILRKVGPVAYQIALPPLLSNLHNVFHVSQLRKYISDPSHIIEPDSIQ |
| ORF Type | 3prime_partial |
| Blastp | Transposon Tf2-8 polyprotein from Schizosaccharomyces with 35.92% of identity |
|---|---|
| Blastx | Transposon Tf2-8 polyprotein from Schizosaccharomyces with 32.19% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (SPAC13D1.01c) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019431322.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer