Protein coding transcript 263716

• Transcript: Ll_transcript_114455
• CDS coordinates: 1-351 (+)
• Peptide sequence: TYNNSFHSSIGMAPYEALYGRKCRTPLCWFETGENLILGPDVVQQTTEKIRMIRENMKTAQSRQKSYYDKRRNLLSFEEGDHVFMRVVPTTGIGRLLKARKLTPKFIGPYQILRKV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_114455

• Blastp: Transposon Tf2-11 polyprotein from Schizosaccharomyces with 30.58% of identity
• Blastx: Transposon Tf2-6 polyprotein from Schizosaccharomyces with 31.79% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC1289.17)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431322.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;