Protein coding transcript 263727

• Transcript: Ll_transcript_115324
• CDS coordinates: 402-767 (+)
• Peptide sequence: MVSRGRMYLAIRKPHILYRIVPISLCYLFQGVFTGKCGTDLDHGVVAVGYGTENGVDYWLVRNSWGGSWGEEGYIKIQRNVRGTSAGKCGITMQASYPVKYGKKSILNSANESTGMYISST*
• ORF Type: complete

Annotations of Ll_transcript_115324

• Blastp: Germination-specific cysteine protease 1 from Arabidopsis with 56.44% of identity
• Blastx: Germination-specific cysteine protease 1 from Arabidopsis with 56.44% of identity
• Eggnog: cathepsin(COG4870)
• Kegg: Link to kegg annotations (AT4G36880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446808.1)
• Pfam: Papain family cysteine protease (PF00112.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;