Transcript | Ll_transcript_115327 |
---|---|
CDS coordinates | 166-900 (+) |
Peptide sequence | MATITILTLLFFFFTLSLALDMSIITYPHNHNQPNPRSNDEVRTMYEEWLVKHQKVYNGLGEKDKRFQVFKDNLVFIDEHNAQNNTYKLGLNKFADLTNEEYRAMYLGTRNDHKRRVMNAKKSGHRYAYEARDRLPVHVDWRLKGAVAPIKDQGGCGSCWAFSTVGAVEGINKIVTGKLVSLSEQELIDCDRIYDEGCNGGLMDYAFEFIISNGGLDTEQDYPYKATDSICDPTRVSILTFPIL* |
ORF Type | complete |
Blastp | Probable cysteine protease RD21B from Arabidopsis with 61.34% of identity |
---|---|
Blastx | Probable cysteine protease RD21B from Arabidopsis with 64% of identity |
Eggnog | cathepsin(COG4870) |
Kegg | Link to kegg annotations (AT5G43060) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446808.1) |
Pfam | Cathepsin propeptide inhibitor domain (I29) (PF08246.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer