Transcript | Ll_transcript_520859 |
---|---|
CDS coordinates | 116-673 (+) |
Peptide sequence | MGSSNNQTILVTGGAGFIGTHTVVQLLNDGYNVSIIDNFDNSVMEAVHRIREVVGPQLSNNLEFTQGDLRNKDDLENLFSKKKFDAVIHFAGLKAVGESVANPRRYFDFNLVGTINLYQVMAKYNCKKMVFSSSATVYGQPETIPCVEDFKLQAMNPYGRTKVTIILLYYLFPFSFHFFARDCSF* |
ORF Type | complete |
Blastp | Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 from Pisum with 76.84% of identity |
---|---|
Blastx | Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 from Pisum with 76.84% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446602.1) |
Pfam | short chain dehydrogenase (PF00106.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer