Protein coding transcript 26373

• Transcript: Ll_transcript_520859
• CDS coordinates: 116-673 (+)
• Peptide sequence: MGSSNNQTILVTGGAGFIGTHTVVQLLNDGYNVSIIDNFDNSVMEAVHRIREVVGPQLSNNLEFTQGDLRNKDDLENLFSKKKFDAVIHFAGLKAVGESVANPRRYFDFNLVGTINLYQVMAKYNCKKMVFSSSATVYGQPETIPCVEDFKLQAMNPYGRTKVTIILLYYLFPFSFHFFARDCSF*
• ORF Type: complete

Annotations of Ll_transcript_520859

• Blastp: Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 from Pisum with 76.84% of identity
• Blastx: Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 from Pisum with 76.84% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446602.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;