Protein coding transcript 263731

• Transcript: Ll_transcript_115330
• CDS coordinates: 958-1473 (+)
• Peptide sequence: MDYAFEFIISNGGLDTEQDYPYKATDSICDPTRKNSKVATIDGYEDVPAYNEKALKKAVAHQPVSVAIEASGRAFQHYNSGVFTGKCGTDLDHGVVAVGYGTENGVDYWLVRNSWGGSWGEEGYIKIQRNVRGTSAGKCGITMQASYPVKYGKKSILNSANESTGMYISST*
• ORF Type: complete

Annotations of Ll_transcript_115330

• Blastp: Cysteine proteinase COT44 from Brassica with 67.31% of identity
• Blastx: Cysteine proteinase COT44 from Brassica with 70.79% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446808.1)
• Pfam: Papain family cysteine protease (PF00112.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;