Protein coding transcript 26379

• Transcript: Ll_transcript_520863
• CDS coordinates: 1249-2370 (+)
• Peptide sequence: MEFGIQIHGLTIKFGHVSDVKCGTALIDLYAKCRSLRSARMVFDKLQNKTIASFNAILVGYLNSKLRDDDEEDPMTFFSKLRFNGMRPDWVTFSRLLSLSANQACLVSGKSLHAYTIKVGLEDDIDVGNAVVTMYAKCGSVPDAYQIFSCMKHDCVTWNAIISAFALHGEGNKALSLFEDMKKEGFAPDKITILAVLQACSYSGLWESGICLFNEMEPKYGIRPVIEHFSCMIDLLGRSGNLPKAIDIINKNPFPKSTLLWRTFVNACKLCGDLQLGMWASEKLLDLAPSDASSYILVSNMYAEGGMLKEAAKVRTAMNDLKLIKETGSSWVEIDNEVHYFIASDKDHPESREIYANLDLLREEIFLELQEQK*
• ORF Type: complete

Annotations of Ll_transcript_520863

• Blastp: Pentatricopeptide repeat-containing protein At4g39530 from Arabidopsis with 39.89% of identity
• Blastx: Pentatricopeptide repeat-containing protein At3g02330, mitochondrial from Arabidopsis with 34.5% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT4G39530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414589.1)
• Pfam: PPR repeat (PF01535.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;