Protein coding transcript 263791

• Transcript: Ll_transcript_114856
• CDS coordinates: 239-679 (+)
• Peptide sequence: MKVTTTTNINYCYNLLMEDQQSSSSSKPKTADLDAPLHSIGFEIEELSPQKVSGHLLVTQKCCQPFKVLHGGVSAMIAEALASMGAHMASGYKRVAGIQLNINHLKRADMGDLVQAEATPLSVGRTIQVLFLISSFLFFGWESYHQ*
• ORF Type: complete

Annotations of Ll_transcript_114856

• Blastp: 1,4-dihydroxy-2-naphthoyl-CoA thioesterase 1 from Arabidopsis with 70.48% of identity
• Blastx: 1,4-dihydroxy-2-naphthoyl-CoA thioesterase 1 from Arabidopsis with 69.81% of identity
• Eggnog: thioesterase Superfamily protein(COG2050)
• Kegg: Link to kegg annotations (AT1G48320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415889.1)
• Pfam: Thioesterase superfamily (PF03061.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;