Protein coding transcript 263801

• Transcript: Ll_transcript_114777
• CDS coordinates: 666-986 (-)
• Peptide sequence: SNLDLNLDWPASSNVSATPSIMLSLGDNIRAELDMQQDKLDQYIKLQKEQLSKGVRDIKQKHVATLLTSIEKGVYKKLKEKDVEIKNMNRMNRELAERIKQVAIEA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_114777

• Blastp: Probable BOI-related E3 ubiquitin-protein ligase 2 from Arabidopsis with 27.16% of identity
• Blastx: Probable BOI-related E3 ubiquitin-protein ligase 2 from Arabidopsis with 29.41% of identity
• Eggnog: protein binding zinc ion binding(ENOG4111S1X)
• Kegg: Link to kegg annotations (AT1G79110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445443.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;