Protein coding transcript 263827

• Transcript: Ll_transcript_115515
• CDS coordinates: 1-1068 (+)
• Peptide sequence: GRPPGHLTWKNFYAYNEVPRKANRDPNDYNFSNSSPISEKFDHNGSKSPCSSNLRNDRKAPKLAQDIGSVAPSGADELERFEDLNVDCNRGKPENYRSDMLNVVKEHKNIKIGHLDQRKGTHDRFMGGNLKLKGPESRSSLIDSNTNKIDRMLDDVDVNECAIPWEDLVIGERIGIGSCGEVFRADWNGTDVAVKKFLDQDFSGDALSEFKREVRIMRRLRHPNIVLFMGAVTRPPNLSIISEFIPRGSLYRILHRPNCQIDEKRRIKMALDVARGMNCLHASNPTIVHRDLKSPNLLVDKNWNVKVCDFGLSRLKHNTFLSSKSTAGTPEWMAPEVLRNEPSNEKCDVYSFGVIL
• ORF Type: internal

Annotations of Ll_transcript_115515

• Blastp: Serine/threonine-protein kinase EDR1 from Arabidopsis with 58.24% of identity
• Blastx: Serine/threonine-protein kinase EDR1 from Arabidopsis with 58.24% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G08720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446943.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;