Protein coding transcript 263829

• Transcript: Ll_transcript_115523
• CDS coordinates: 1-825 (+)
• Peptide sequence: GRPPGHLTWKNFYAYNEVPRKANRDPNDYNFSNSSPISEKFDHNGSKSPCSSNLRNDRKAPKLAQDIGSVAPSGADELERFEDLNVDCNRGKPENYRSDMLNVVKEHKNIKIGHLDQRKGTHDRFMGGNLKLKGPESRSSLIDSNTNKIDRMLDDVDVNECAIPWEDLVIGERIGIGSCGEVFRADWNGTDVAVKKFLDQDFSGDALSEFKREVRIMRRLRHPNIVLFMGAVTRPPNLSIISEFIPRGSLYRILHRPNCQIDEKRRIKMALDVV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_115523

• Blastp: Serine/threonine-protein kinase EDR1 from Arabidopsis with 48.3% of identity
• Blastx: Probable serine/threonine-protein kinase PBL10 from Arabidopsis with 81.08% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G08720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447953.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;