Protein coding transcript 263835

• Transcript: Ll_transcript_115504
• CDS coordinates: 2-484 (+)
• Peptide sequence: CIDENSFAPAKPGTGIVIAVKRLNQDSVQGHREWLAEVNFLGQFSHPHLVKLIGYCLEDEHRLLVYEFMPRGSLENHLFRRGSYFQPLSWRLRLKVALDAAKGLAFLHNAENKVIYRDFKTSNILLDSNYRAKLSDFGLAKDGPTGDKSHVSTRVMGTYGY
• ORF Type: internal

Annotations of Ll_transcript_115504

• Blastp: Probable serine/threonine-protein kinase PBL10 from Arabidopsis with 87.5% of identity
• Blastx: Probable serine/threonine-protein kinase PBL10 from Arabidopsis with 87.5% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G28930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458542.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;