Transcript | Ll_transcript_115504 |
---|---|
CDS coordinates | 2-484 (+) |
Peptide sequence | CIDENSFAPAKPGTGIVIAVKRLNQDSVQGHREWLAEVNFLGQFSHPHLVKLIGYCLEDEHRLLVYEFMPRGSLENHLFRRGSYFQPLSWRLRLKVALDAAKGLAFLHNAENKVIYRDFKTSNILLDSNYRAKLSDFGLAKDGPTGDKSHVSTRVMGTYGY |
ORF Type | internal |
Blastp | Probable serine/threonine-protein kinase PBL10 from Arabidopsis with 87.5% of identity |
---|---|
Blastx | Probable serine/threonine-protein kinase PBL10 from Arabidopsis with 87.5% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT2G28930) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458542.1) |
Pfam | Protein tyrosine kinase (PF07714.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer