Protein coding transcript 263840

• Transcript: Ll_transcript_115489
• CDS coordinates: 3-707 (+)
• Peptide sequence: NFDYAELAAATNDFSDENMIGKGGHAEVFRGYLPDGQVIAVKRLMKNEKDPGDRACDFLTELGMIAHINHPNATHLVGFGIERGLYFVLQFAQNGSLSSMLFGSECFEWKKRFNVAVGVAEGLLYLHQDCPRRIIHRDIKASNILLNDNYEAEISDFGLAKWLPGKWSHHVVFPIEGTFGYLAPEYFMHGVVDEKTDVFAFGVLLLELITGRRAVDSDSRQSLVVWAKPLLETNN
• ORF Type: internal

Annotations of Ll_transcript_115489

• Blastp: Receptor-like cytosolic serine/threonine-protein kinase RBK1 from Arabidopsis with 70.76% of identity
• Blastx: Receptor-like cytosolic serine/threonine-protein kinase RBK1 from Arabidopsis with 70.76% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G10520)
• CantataDB: Link to cantataDB annotations (CNT0000970)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445378.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;