Protein coding transcript 263846

• Transcript: Ll_transcript_115479
• CDS coordinates: 3-725 (+)
• Peptide sequence: NFDYAELAAATNDFSDENMIGKGGHAEVFRGYLPDGQVIAVKRLMKNEKDPGDRAGDFLSELGIIAHINHYNATHLVGFGVERGLYFVLQFAPHGSLSSTLFGSECFEWNKRFKVAIGVAEGLLYLHQDCPRRIIHRDIKASNILLNDNYEAEISDFGLAKWLPSKWSHHVVFPIEGTFGYLAPEYFMHGVVDEKTDVFAFGVLLLELITGRRAVDSDSRQSLVIWVTLINPLCPMEYLE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_115479

• Blastp: Receptor-like cytosolic serine/threonine-protein kinase RBK1 from Arabidopsis with 71.05% of identity
• Blastx: Receptor-like cytosolic serine/threonine-protein kinase RBK1 from Arabidopsis with 71.37% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G10520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422486.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;