Protein coding transcript 263847

• Transcript: Ll_transcript_115481
• CDS coordinates: 398-1066 (+)
• Peptide sequence: MIGKGGHAEVFRGYLPDGQVIAVKRLMKNEKDPGDRAGDFLSELGIIAHINHYNATHLVGFGVERGLYFVLQFAPHGSLSSTLFGSECFEWNKRFKVAIGVAEGLLYLHQDCPRRIIHRDIKASNILLNDNYEAEISDFGLAKWLPSKWSHHVVFPIEGTFGYLAPEYFMHGVVDEKTDVFAFGVLLLELITGRRAVDSDSRQSLVIWVTLINPLCPMEYLE*
• ORF Type: complete

Annotations of Ll_transcript_115481

• Blastp: Receptor-like cytosolic serine/threonine-protein kinase RBK1 from Arabidopsis with 71.9% of identity
• Blastx: Receptor-like cytosolic serine/threonine-protein kinase RBK1 from Arabidopsis with 72.17% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G10520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422486.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;