Protein coding transcript 263925

• Transcript: Ll_transcript_115059
• CDS coordinates: 2-799 (+)
• Peptide sequence: LDVAKSIAVEVQSESKWKQLGELAMSSGKLAMAEECLERAMDLSGLLLLYSSLGDAEGISKLATLAKEQGKNNVSFLCLFMLGRLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLNKVNPKAAESLADPEEYPNLFEDWQIALAVESKAVESRNVYPPAEQYINHADKPHVTLVEAFRNLQIEGEEPLENGDSNHELTEENGEEDYTEAQEEPNGEEGSQEEAVVVDADSTDGAVLVNGNEAEEEWGTNNQGAPSA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_115059

• Blastp: Coatomer subunit beta'-2 from Arabidopsis with 76.47% of identity
• Blastx: Coatomer subunit beta'-2 from Arabidopsis with 76.47% of identity
• Eggnog: coatomer protein complex, subunit beta 2 (beta prime)(ENOG410XNNY)
• Kegg: Link to kegg annotations (AT1G52360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436408.1)
• Pfam: Coatomer WD associated region (PF04053.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;