Transcript | Ll_transcript_115052 |
---|---|
CDS coordinates | 2-799 (+) |
Peptide sequence | LDVAKSIAVEVQSESKWKQLGELAMSSGKLAMAEECLERAMDLSGLLLLYSSLGDAEGISKLATLAKEQGKNNVSFLCLFMLGRLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLNKVNPKAAESLADPEEYPNLFEDWQIALAVESKAVESRNVYPPAEQYINHADKPHVTLVEAFRNLQIEGEEPLENGDSNHELTEENGEEDYTEAQEEPNGEEGSQEEAVVVDADSTDGAVLVNGNEAEEEWGTNNQGAPSA* |
ORF Type | 5prime_partial |
Blastp | Coatomer subunit beta'-2 from Arabidopsis with 76.47% of identity |
---|---|
Blastx | Coatomer subunit beta'-2 from Arabidopsis with 76.47% of identity |
Eggnog | coatomer protein complex, subunit beta 2 (beta prime)(ENOG410XNNY) |
Kegg | Link to kegg annotations (AT1G52360) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436408.1) |
Pfam | Coatomer WD associated region (PF04053.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer