Protein coding transcript 263938

• Transcript: Ll_transcript_115054
• CDS coordinates: 500-1210 (+)
• Peptide sequence: MFLQLAMAEECLERAMDLSGLLLLYSSLGDAEGISKLATLAKEQGKNNVSFLCLFMLGRLEDCLQLLVESNRIPEAALMARSYLPSKVSEIVAIWRKDLNKVNPKAAESLADPEEYPNLFEDWQIALAVESKAVESRNVYPPAEQYINHADKPHVTLVEAFRNLQIEGEEPLENGDSNHELTEENGEEDYTEAQEEPNGEEGSQEEAVVVDADSTDGAVLVNGNEAEEEWVLAPHH*
• ORF Type: complete

Annotations of Ll_transcript_115054

• Blastp: Coatomer subunit beta'-2 from Arabidopsis with 74.79% of identity
• Blastx: Coatomer subunit beta'-2 from Arabidopsis with 74.79% of identity
• Eggnog: coatomer protein complex, subunit beta 2 (beta prime)(ENOG410XNNY)
• Kegg: Link to kegg annotations (AT1G52360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457561.1)
• Pfam: Coatomer WD associated region (PF04053.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;