Protein coding transcript 263949

• Transcript: Ll_transcript_113019
• CDS coordinates: 228-743 (+)
• Peptide sequence: MKLIIETFSYTLIWKVPIPPVNIYSIDDALEADGAADVYETTLRRLVKNGVIATSENGFPKFDLMLLGMGQDGHVASLFPRHSLVKEDKKWVSFIKDSPKPPSDRITLTFPVINACSNIAMVVTGAGKNGAVYSALRGDEKSDKLPAGLVSSEGELKWYLDIGAASMLFKE*
• ORF Type: complete

Annotations of Ll_transcript_113019

• Blastp: Probable 6-phosphogluconolactonase 4, chloroplastic from Oryza sativa with 60% of identity
• Blastx: Probable 6-phosphogluconolactonase 4, chloroplastic from Oryza sativa with 63.06% of identity
• Eggnog: Catalyzes the reversible isomerization-deamination of glucosamine 6-phosphate (GlcN6P) to form fructose 6-phosphate (Fru6P) and ammonium ion (By similarity)(COG0363)
• Kegg: Link to kegg annotations (4347654)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459494.1)
• Pfam: Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase (PF01182.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;