Protein coding transcript 264

• Transcript: Ll_transcript_477626
• CDS coordinates: 1-378 (+)
• Peptide sequence: KYLAKVKELNAFDLISFASGLDLSGLFKDPSDSVFLERFLCREGVERIVEEVAEIERVVVKKDENGCGGVRLEGSDGNFMVLVGVYRLTVDFVVIEVKSGERGVESGARFWRDKLRLVLRELAEK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_477626

• Blastp: CBL-interacting serine/threonine-protein kinase 14 from Arabidopsis with 39.34% of identity
• Blastx: CBL-interacting serine/threonine-protein kinase 14 from Arabidopsis with 36.29% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G01820)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462821.1)
• Pfam: NAF domain (PF03822.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;