Protein coding transcript 264056

• Transcript: Ll_transcript_115612
• CDS coordinates: 3-512 (+)
• Peptide sequence: RTVMLMEKLVGNDNLLPGLKFLFVFIETVLNDCGSDITSSRRTTKKCSSGNAPGVVGHVAVQPVGSRKNIEKCTLSANQEGSDSLEWDAASVDEDDATSDGEVVSIDKDDEDANNERALASKVCTFTSSGNNYMEQHWYFCYTCDLTVSKGCCSVCAKVCHRGHRVVYSR
• ORF Type: internal

Annotations of Ll_transcript_115612

• Blastp: Auxin transport protein BIG from Arabidopsis with 58.47% of identity
• Blastx: Auxin transport protein BIG from Arabidopsis with 60.92% of identity
• Eggnog: Ubiquitin protein ligase E3 component n-recognin 4(ENOG410XPP8)
• Kegg: Link to kegg annotations (AT3G02260)
• CantataDB: Link to cantataDB annotations (CNT0002836)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442749.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;