Protein coding transcript 264235

• Transcript: Ll_transcript_115577
• CDS coordinates: 2-334 (+)
• Peptide sequence: QKVVLPKIQKLLDSESERVNVNISLAALKLLKLLPGAVMDLYLPAIILRICNFLTNNQESIRDEARSALATCLKELGLEYLQSIVRDMRSTLKQGYGHVLGYSLNYILSKC
• ORF Type: internal

Annotations of Ll_transcript_115577

• Blastp: Small subunit processome component 20 homolog from Mus with 33.33% of identity
• Blastx: Small subunit processome component 20 homolog from Homo with 33.33% of identity
• Eggnog: UTP20, small subunit (SSU) processome component, homolog (yeast)(ENOG410XSRE)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438350.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;