Protein coding transcript 264237

• Transcript: Ll_transcript_115579
• CDS coordinates: 128-1000 (+)
• Peptide sequence: MATLSHAQAVKSLNKSPGRRRFVFKSFNDRVNDIDINVYRSLDKLKPAPSDGSFFRDCLMEWRELNTAEDFISLYEEIMPYTQTLPLVLLHKESLITKLLSRLHMKARLSVDAILRLIAALSRDLLDEFVPLFPRIVDSLVSLLESGGDREPDIIEQIFTSWSCVMMYLQKYLIDDPSVVLKVTEKLRYYPKKYVQQFMAEAMSYVLRNVPKDEQLERGIGIVMDEAVKDPSSCIESVSELLYNIMKCYSSRFHSKSKRVLKLLTSEAFYGRGDIANQGKLILFSTFKHI*
• ORF Type: complete

Annotations of Ll_transcript_115579

• Blastp: Small subunit processome component 20 homolog from Homo with 26.23% of identity
• Blastx: Small subunit processome component 20 homolog from Homo with 26.19% of identity
• Eggnog: UTP20, small subunit (SSU) processome component, homolog (yeast)(ENOG410XSRE)
• Kegg: Link to kegg annotations (27340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438350.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;