Protein coding transcript 264270

• Transcript: Ll_transcript_77739
• CDS coordinates: 84-896 (+)
• Peptide sequence: MEKVEQTNDALSNIDLKDKQLNHKNTILEEKSFTYALQLVNSSVLSMALKSAIELGVFDIINKAGVGAKLSAKDIAEEFSCKNPDATTMLDRILRLLANHSIVDCVVVDDKNGPPPHLQRLYSMAPVTTYFVSNGGGGSLAPLMVFTHDKITFESWYQLKDAILEGGTPFNMVHGKHIFQYANLNSSFNQLFNIAMISGTTLTMNKIVESYKGFEHINKLIDVGGGLGIALNIITSKYPHIQGVNFDLPQVIERASPYPGIASLAYIYIYI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_77739

• Blastp: Caffeic acid 3-O-methyltransferase 1 from Populus with 50.64% of identity
• Blastx: Caffeic acid 3-O-methyltransferase from Capsicum with 47.5% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459523.1)
• Pfam: Dimerisation domain (PF08100.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;