| Transcript | Ll_transcript_77742 |
|---|---|
| CDS coordinates | 236-535 (+) |
| Peptide sequence | MVHGKHIFQYANLNSSFNQLFNIAMISGTTLTMNKIVESYKGFEHINKLIDVGGGLGIALNIITSKYPHIQGVNFDLPQVIERASPYPGIASLAYIYIYI |
| ORF Type | 3prime_partial |
| Blastp | Anthranilate N-methyltransferase from Ruta with 55.06% of identity |
|---|---|
| Blastx | Anthranilate N-methyltransferase from Ruta with 55.34% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019459523.1) |
| Pfam | O-methyltransferase (PF00891.17) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer