Protein coding transcript 26432

• Transcript: Ll_transcript_521071
• CDS coordinates: 77-445 (+)
• Peptide sequence: MATSTSSTIFSSSLISGRTTPILNNQVMFLKNHYLNNSVSQKKRVFFSVQAQASKPPSGVEFPKVQPQIKGPFVGFTNTAEVWNSRASMIGLIGTFIVELVSILYVHHLIFYYHIYDRVLRF*
• ORF Type: complete

Annotations of Ll_transcript_521071

• Blastp: Light-harvesting complex-like protein OHP1, chloroplastic from Arabidopsis with 66% of identity
• Blastx: Light-harvesting complex-like protein OHP1, chloroplastic from Arabidopsis with 66% of identity
• Eggnog: One helix protein(ENOG410YTYC)
• Kegg: Link to kegg annotations (AT5G02120)
• CantataDB: Link to cantataDB annotations (CNT0002959)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413508.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;