Protein coding transcript 264420

• Transcript: Ll_transcript_70742
• CDS coordinates: 1-423 (-)
• Peptide sequence: MHQTSNKHSLHHNCNSYHLCSQPKATMMSQTLLSISLTLLVLPLFYSTTTLAALSPLGAPVQPTPAPTPPAAAPTTPLVPTSPGDNSPDTTTTSIDIAGILRKANSFNIFIRLLKTTQLINQLNSQLVTIKSGGLTILAPD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_70742

• Blastp: Fasciclin-like arabinogalactan protein 11 from Arabidopsis with 53.33% of identity
• Blastx: Fasciclin-like arabinogalactan protein 11 from Arabidopsis with 53.33% of identity
• Eggnog: Arabinogalactan protein(ENOG410YFHZ)
• Kegg: Link to kegg annotations (AT5G03170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447898.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;