Protein coding transcript 264448

• Transcript: Ll_transcript_12682
• CDS coordinates: 2-514 (+)
• Peptide sequence: EVMAKYKPADPKLDADNIRSFVQSFLDGKLKQHLLSQDLPEDWDKNPVKTLVSSNFDEIAFDKEKDVLVEFYAPWCGHCKQLAPIYDQLGEKFKDNPSIVVAKMDATINELEHTKVPSFPTLKLYAKGDNKVIEYNGERTLEGLTKFLETGGAYGQAAPEEAEDVDEDDDQ
• ORF Type: internal

Annotations of Ll_transcript_12682

• Blastp: Protein disulfide-isomerase from Sophophora with 68.67% of identity
• Blastx: Protein disulfide-isomerase from Sophophora with 68.42% of identity
• Eggnog: Thioredoxin(COG0526)
• Kegg: Link to kegg annotations (Dmel_CG6988)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458628.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;