Transcript | Ll_transcript_66487 |
---|---|
CDS coordinates | 3-524 (+) |
Peptide sequence | TASPMQSIQTAFRSPLGRNVLNGCARSIHSSNFLNMPVKVGDKVPSVDLYEKTPANKVNFASLCEGKKVIVFGVPGAFTPGCSKTHLPGYIADADKLKSQGVGEIVCISVNDAFVMDAWAQAHKTEGKVRMLADPSAQLTKQLGLEQDLPPLGGIRSKRFSMVVESGVVKSLNV |
ORF Type | internal |
Blastp | Peroxiredoxin-5, mitochondrial from Bos with 54.84% of identity |
---|---|
Blastx | Peroxiredoxin-5, mitochondrial from Bos with 54.84% of identity |
Eggnog | peroxiredoxin(COG0678) |
Kegg | Link to kegg annotations (282885) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (NP_001235797.1) |
Pfam | Redoxin (PF08534.9) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer