Protein coding transcript 264508

• Transcript: Ll_transcript_41192
• CDS coordinates: 1-549 (+)
• Peptide sequence: QECVPENLELKRKVWKNVDDVATPNTIFSSSTSTFLPSTFSDHLKNKKNIIVSHPVNPPYYVPLIEIIPAPWTDLAVQKKTRAIMEEIGQTPVNLTKEVPGFVVNRLQYALINECWNLVTEGVLDVKDIDKVMSDGLGMRYAFLGVLETTHLNAEGFKKYCDSYAKTIHAVSLDLKPVPKLEG
• ORF Type: internal

Annotations of Ll_transcript_41192

• Blastp: Lambda-crystallin homolog from Homo with 52.49% of identity
• Blastx: Lambda-crystallin homolog from Bos with 54.1% of identity
• Eggnog: Dehydrogenase(COG1250)
• Kegg: Link to kegg annotations (51084)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003628547.1)
• Pfam: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain (PF02737.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;