Transcript | Ll_transcript_66478 |
---|---|
CDS coordinates | 2-520 (+) |
Peptide sequence | VKIPVENVVGGVGNGFKVAMNVLNNGRFGMAAALAGTMKACTKKAVDFATQRTQFGAKIDSFGAIQEKIARMATLQYVTESMAYMISGNMDQGSQHYHLEAAISKCFASEAAWYVCDEAIQIMGGMGFMKETGLERVMRDLRIFRIFEGTNDILRLFVALTGIQYAGAHLKEL |
ORF Type | internal |
Blastp | Very long-chain specific acyl-CoA dehydrogenase, mitochondrial from Rattus with 73.99% of identity |
---|---|
Blastx | Very long-chain specific acyl-CoA dehydrogenase, mitochondrial from Rattus with 73.99% of identity |
Eggnog | acyl-CoA dehydrogenase(COG1960) |
Kegg | Link to kegg annotations (25363) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020214933.1) |
Pfam | Acyl-CoA dehydrogenase, C-terminal domain (PF00441.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer