Protein coding transcript 264555

• Transcript: Ll_transcript_27939
• CDS coordinates: 1-426 (+)
• Peptide sequence: EVIPNKMGKIMKQGKVVLVLGGRYAGRKAIVVKNYDDGTSDKQYGHALVAGIDRYPRKIHKRMGKGKMHKRSKIKPFVKVLNYNHLMPTRYSVDLTSDLKVAPKDLKDKMKRKKIRFQTRVKFEERYKQGKNKWFFSKLRF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_27939

• Blastp: 60S ribosomal protein L27 from Danio with 69.12% of identity
• Blastx: 60S ribosomal protein L27 from Danio with 69.12% of identity
• Eggnog: (ribosomal) protein(COG2163)
• Kegg: Link to kegg annotations (325618)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003594893.2)
• Pfam: KOW motif (PF00467.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;