Protein coding transcript 264565

• Transcript: Ll_transcript_27978
• CDS coordinates: 1-456 (-)
• Peptide sequence: KTAVDAWGTVDVLINNAGITRDGLLMRMKKSQWQDVIDLNLTGVFLCTQAAAKIMMKKRKGRIINIASVVGLVGNVGQANYSAAKAGVIGLTKAVAKEYSSRSITVNAVAPGFIASDMPSKLGDDIEKKILETIPLGRYGQPEEVAGLVEFL
• ORF Type: internal

Annotations of Ll_transcript_27978

• Blastp: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic from Cuphea with 90.79% of identity
• Blastx: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic from Cuphea with 90.79% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002448)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438315.1)
• Pfam: Enoyl-(Acyl carrier protein) reductase (PF13561.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;