Protein coding transcript 264710

• Transcript: Ll_transcript_41400
• CDS coordinates: 1-381 (+)
• Peptide sequence: MKAGEVMNNDLFGILLESNHKEIQEHGNNKDIGMSLQDIIEECKLFYFAGEQTTSVLLVWTMVVLSRYPDWQARAKDEVFQVFGNQKPDFDGLSHLKIVTMILYEVLRLYPPVPGLGRTVHKDMKVG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_41400

• Blastp: 11-oxo-beta-amyrin 30-oxidase from Medicago with 66.14% of identity
• Blastx: 11-oxo-beta-amyrin 30-oxidase from Medicago with 66.14% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453665.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;