Protein coding transcript 264780

• Transcript: Ll_transcript_240045
• CDS coordinates: 1-297 (+)
• Peptide sequence: LPWTASIASKFNIPRVIFHIVSCFTLLCSHNIAISKVHESVTSMTKTFVVPDLPDRIEFTKSQLPEAMRSQDSKGWKDTIDQFKASEILAQGILVNSFE
• ORF Type: internal

Annotations of Ll_transcript_240045

• Blastp: UDP-glycosyltransferase 73C3 from Arabidopsis with 42% of identity
• Blastx: UDP-glycosyltransferase 73C3 from Arabidopsis with 42% of identity
• Eggnog: Transferase(COG1819)
• Kegg: Link to kegg annotations (AT2G36780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456382.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;