Protein coding transcript 264819

• Transcript: Ll_transcript_157229
• CDS coordinates: 1-741 (+)
• Peptide sequence: LALNIGVSQVVYPVYRNIIALLLLSPLAYILEKNQRPPLTLPLLVQFFLLALIGITANQGFYLLGLYYASPTFASAMQNSVPAITFVLASVLGLEEVNITRRDGLAKFLGTIACVGGATIITLYKGLPLLQEQTHQIQGDNFEVDQSSTKNQNWTLGCLYLLGHCLSWAGWMVFQAPVVKKYPAKLTLTSFTCFFGLIQFLIIAAFVETDLEHWKIQSMEELFTILYAGIVASGIVISLQTWCIQKG
• ORF Type: internal

Annotations of Ll_transcript_157229

• Blastp: WAT1-related protein At3g18200 from Arabidopsis with 68.55% of identity
• Blastx: WAT1-related protein At3g18200 from Arabidopsis with 68.55% of identity
• Eggnog: Auxin-induced protein(ENOG410YAV4)
• Kegg: Link to kegg annotations (AT3G18200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436044.1)
• Pfam: EamA-like transporter family (PF00892.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;