| Transcript | Ll_transcript_46772 |
|---|---|
| CDS coordinates | 2-409 (+) |
| Peptide sequence | FNMKHKIDISGNARALGKLRSACERAKRLLSSTSQTIIEIDSLAGDIDLHAVVTRAAFEELNKDLFAKCMEIVEKCLVEAKVHKSQVHEYVLVGGSTRIPKVQQLLKDFFNVNELCKSINPDEAVAYGAAVQAAIL |
| ORF Type | internal |
| Blastp | Heat shock 70 kDa protein from Soja with 77.21% of identity |
|---|---|
| Blastx | Heat shock 70 kDa protein from Soja with 74.8% of identity |
| Eggnog | Heat shock protein(COG0443) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019439663.1) |
| Pfam | Hsp70 protein (PF00012.19) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer