Protein coding transcript 264968

• Transcript: Ll_transcript_272216
• CDS coordinates: 61-489 (+)
• Peptide sequence: MNSMASNLKPAFAYTVFYVKDVAKSVAFYAKAFGFSVHRLDESHRWGELESGGTTIAFTPLHQHETDDLTGVVHTPRSSQERQPVEVCFVYPDVDAAYKWAVENGAVAVSEPELKEWGQKVGYVRDPDGIVVRMGSHVNQTK*
• ORF Type: complete

Annotations of Ll_transcript_272216

• Blastp: Uncharacterized protein Rv0887c from Mycobacterium tuberculosis complex with 30% of identity
• Blastx: Uncharacterized protein Rv0887c from Mycobacterium tuberculosis complex with 30% of identity
• Eggnog: glyoxalase bleomycin resistance protein dioxygenase(COG2764)
• Kegg: Link to kegg annotations (Rv0887c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413828.1)
• Pfam: Glyoxalase-like domain (PF12681.6)
• Rfam: -
• GO: -