Protein coding transcript 265019

• Transcript: Ll_transcript_116595
• CDS coordinates: 1-621 (+)
• Peptide sequence: IGEKGSKDLKIGKVRIRISTLETERIYTHSYPLLVLHPTGVKKMGELHLAIRFSCTSFANMLYLYSKPLLPKMHYVRPFSVMQLDMLRHQAVNIVAARLGRAEPPLRKEVVEYMSDVDSHLWSMRRSKANFFRLMTLFSGVFAVGKWFGDICMWRNPITTVLVHVLFLMLVCFPELILPTVFLYMFLIGVWNFRYRPRYPPHMNTRI
• ORF Type: internal

Annotations of Ll_transcript_116595

• Blastp: FT-interacting protein 1 from Arabidopsis with 70.1% of identity
• Blastx: FT-interacting protein 1 from Arabidopsis with 70.1% of identity
• Eggnog: Multiple C2 and transmembrane domain-containing protein(ENOG410XRQN)
• Kegg: Link to kegg annotations (AT5G06850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444669.1)
• Pfam: Plant phosphoribosyltransferase C-terminal (PF08372.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;