Protein coding transcript 265027

• Transcript: Ll_transcript_216681
• CDS coordinates: 1-645 (+)
• Peptide sequence: EESESVRFECKVEPKDDPKLRIEWYRNGKLLPSGHRYKTVHDMGFVSLTILYVYSEDSGEYVCRAVNDHGEDFTKASVSCKKLPSIILQNQVPKGMKRSETLMQMEAAIKKYTSEIYLTEDDLYDIEKKQPPRFVTQIKDQTELVEMQVTKFECQLAPVGDPNMKVEWFLNGKPLPHKNRFTPIYDFGYVAMNFGWVYPEDSGEYLCRATNLYGM
• ORF Type: internal

Annotations of Ll_transcript_216681

• Blastp: Titin from Sophophora with 80.37% of identity
• Blastx: Titin from Sophophora with 80.37% of identity
• Eggnog: IG_like(ENOG410XTJ8)
• Kegg: Link to kegg annotations (Dmel_CG1915)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016163129.1)
• Pfam: Immunoglobulin I-set domain (PF07679.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;