Protein coding transcript 265034

• Transcript: Ll_transcript_216659
• CDS coordinates: 281-799 (+)
• Peptide sequence: MSSSSSLSSKKHPVYHGIRRRGGKWVSEIREPRKANRIWLGTFLTPEMAAAAYDVAALALKGGEAVLNFPESMGKYPVPATNSSDDIRAAAIDAAALMNAPEASHNQLSNVFQLENAATPWFSETGFLDEETIFSMPSLLMDMAQGMLLSPPRMSPHNSPENSVGESLWNYF*
• ORF Type: complete

Annotations of Ll_transcript_216659

• Blastp: Ethylene-responsive transcription factor ERF026 from Arabidopsis with 53.63% of identity
• Blastx: Ethylene-responsive transcription factor ERF026 from Arabidopsis with 55.62% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432066.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;