Protein coding transcript 265054

• Transcript: Ll_transcript_239685
• CDS coordinates: 1-609 (+)
• Peptide sequence: YEPLLKLLESLSQEEKVILVGHSLGGVSMSVAMERFPEKISVAVFVTAYVISENLTYLDLLQELGKSAGSRMDTQFFFFDGPNKPATARLIGPKFMASKMYQLSPPQDLTLALTLVRPVPIYNDVQLLVKETEVSNGRNGKVPKVFIISERDKLITKDIQMWMIGKTGPFAEIKVIKDSDHMVMFSQPRILTTHLIKIGHKY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_239685

• Blastp: Salicylic acid-binding protein 2 from Nicotiana with 41.58% of identity
• Blastx: Salicylic acid-binding protein 2 from Nicotiana with 39.89% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107791137)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463119.1)
• Pfam: Alpha/beta hydrolase family (PF12697.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;